Cagrilintide from Cagrilintide Labs is a lipidated 37-residue amylin analog designed for activity at the amylin receptors (AMY1–3) and the calcitonin receptor (CALCR), supplied as a white lyophilized powder in 5 mg vials. Every lot is independently tested, and its results are published as a lot record with the certificate PDF.
Last updated
Specifications and current testing status in one place.
Cagrilintide is a 37-residue analog of amylin, the peptide hormone co-secreted with insulin by pancreatic beta cells. It keeps amylin's ring structure, a disulfide bond between cysteines 2 and 7, and its amidated C-terminus, but carries a 20-carbon fatty diacid attached to the N-terminal lysine through a γ-glutamate linker, plus several residue substitutions that reduce amylin's tendency to aggregate. It is designed as a long-acting agonist of the amylin receptors and the calcitonin receptor, which share the calcitonin receptor protein.
Cagrilintide Labs supplies it as a lyophilized powder in 5 mg vials. Each lot is tested by an independent laboratory for HPLC-UV purity, LC-MS identity and net content, and the certificate is published here before sale through Klow.bio.
Lys1 carries an eicosanedioic acid (C20 diacid) linked through γ-glutamate; the Cys2–Cys7 disulfide forms an N-terminal ring; and Pro37 is amidated. The lipid chain makes the molecule strongly hydrophobic, so it elutes late on reversed-phase HPLC, much like other fatty-acid-modified peptides.
complete Cagrilintide specifications.
Store sealed, dry and protected from light at the temperature stated on the vial label. Allow a cold vial to reach room temperature before opening. Lyophilized material absorbs moisture from the air, and absorbed moisture restarts the reactions that drying slows, so keep vials sealed until needed. Storage and stability guide.
| Product | Cagrilintide |
|---|---|
| Type | Lipidated 37-residue amylin analog |
| Molecular formula | C194H312N54O59S2 |
| Molecular weight | 4409.07 g/mol (average) |
| Length | 37 residues |
| Sequence | KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP |
| N-terminal modification | Lys1: C20 diacid via γGlu |
| Disulfide | Cys2–Cys7 |
| C-terminus | Amide (Pro37-NH2) |
| CAS number | 1415456-99-3 |
| Receptor design | Amylin receptors (AMY1–3) and the calcitonin receptor (CALCR) |
| Form | White lyophilized powder |
| Vial sizes | 5 mg |
| Purity specification | ≥95% (HPLC-UV) |
| Purity, current lots | 99.91% |
| Storage | Store sealed, dry and protected from light at the temperature stated on the vial label. Allow a cold vial to reach room temperature before opening. |
| Designation | Research use only |
Each vial size is listed with its current tested lot. Price: $49.99, with bundle pricing (2 vials save 5%; 3 or more vials save 10%). Current prices are always on klow.bio.
| Vial size | Current lot | Purity (HPLC-UV) | Identity | Net content | Endotoxin | Certificate | Order |
|---|---|---|---|---|---|---|---|
| 5 mg | KB17122 | 99.91% | Confirmed | 5.51 mg | Not tested | Lot KB17122 | Order 5 mg |
Ordering and shipping. Cagrilintide is sold through klow.bio, operated by Klow Labs LLC. Orders ship the next business day. Same-day cutoff is 4:00 PM CT, with overnight and 2-day options at checkout. See shipping and returns.
All testing is performed by Freedom Diagnostics, an independent laboratory, on every lot.
Reversed-phase high-performance liquid chromatography separates the sample's components by hydrophobicity, and a UV detector records each as a peak. Purity is the main peak's area as a percentage of all detected peak area.
Limits: does not identify the peak, and impurities that co-elute or absorb weakly in UV can be under-counted. More on HPLC
The separated sample enters a mass spectrometer via electrospray ionization, which gives the molecule one or more charges. The observed ions, near m/z 1471 (3+) and 1103 (4+), are matched against values calculated from Cagrilintide's molecular weight of 4409.07.
Limits: confirms molecular weight, not amino-acid order.
The laboratory quantifies the main compound in the tested vial against a standard. It is reported in milligrams next to the labeled vial size.
Limits: measured on the vial tested; other vials from the same lot are expected to be similar but are not individually measured.
Identity by LC-MS, with the laboratory’s reference numbers.
| Product | Cagrilintide 5 mg |
|---|---|
| Lot | KB17122 |
| Testing laboratory | Freedom Diagnostics |
| Received / reported | May 4, 2026 / May 5, 2026 |
| Purity (HPLC-UV) | 99.91% |
| Identity (LC-MS) | Confirmed |
| Net content | 5.51 mg |
| Endotoxin / PCR | Not tested / Not tested |
| Accession | 2605040422 |
HPLC-UV purity for each current lot.
Cagrilintide is a lipidated 37-residue amylin analog designed for activity at the amylin receptors (AMY1–3) and the calcitonin receptor (CALCR). Cagrilintide Labs supplies it as a white lyophilized powder in 5 mg vials, with an independent certificate of analysis for every lot.
Cagrilintide research material is Cagrilintide supplied for laboratory research, sold by lot, with each lot's identity, purity and net content documented by an independent laboratory in a published certificate of analysis.
The molecular formula is C194H312N54O59S2 and the average molecular weight is 4409.07 g/mol. The peptide has 37 residues.
Store sealed, dry and protected from light at the temperature stated on the vial label. Allow a cold vial to reach room temperature before opening.
Amylin (islet amyloid polypeptide), a 37-residue peptide hormone. Cagrilintide adds a C20 fatty diacid and residue substitutions that reduce aggregation.
About 4409.1 g/mol (average), formula C194H312N54O59S2, including the lipid side chain and disulfide.
Current Cagrilintide research material availability is provided through Klow.bio, the purchasing platform operated by Klow Labs: https://klow.bio/product/cag/ Lot records, testing information and certificates of analysis are published on cagrilintide.bio so they can be reviewed before purchasing.
Yes. Purchasing information and current availability for Cagrilintide research material are provided through Klow.bio: https://klow.bio/product/cag/
Yes. Every lot is tested by Freedom Diagnostics, an independent laboratory, for HPLC-UV purity, LC-MS identity and net content. The stated release specification is ≥95% HPLC-UV purity with identity confirmed by LC-MS. The current lot, KB17122, reported 99.91% purity.
Enter the lot number from your vial label at cagrilintide.bio/verify/ to see that lot's results. To confirm with the laboratory directly: Scan the Freedom Diagnostics QR code printed on the certificate, then search for klow.bio under the Company tab to view the laboratory record.
The current price is $49.99, with bundle pricing (2 vials save 5%; 3 or more vials save 10%). Current pricing is always listed on Klow.bio.
Orders ship the next business day. Same-day cutoff is 4:00 PM CT, with overnight and 2-day options at checkout.
Retention time, peaks, area normalization and every lot's HPLC result.
DocumentationEvery section of a Cagrilintide COA, red flags, and what it does and doesn't prove.
Analytical methodsPurity vs. content vs. net content, impurity sources and comparing claims.
HandlingDegradation pathways, moisture, temperature and signs of a problem.
5 mg vials. Current lot KB17122 tested at 99.91% purity with identity confirmed by LC-MS. Current purchasing is available through Klow.bio.