Cagrilintide specifications and molecular characteristics
The technical specification for Cagrilintide, the Cagrilintide research material supplied by Cagrilintide Labs: molecular formula C194H312N54O59S2, average molecular weight 4409.07 g/mol, 37 residues, supplied as a white lyophilized powder. Each item is explained below.
Last updated
Specification table
| Product | Cagrilintide |
|---|---|
| Type | Lipidated 37-residue amylin analog |
| Molecular formula | C194H312N54O59S2 |
| Molecular weight | 4409.07 g/mol (average) |
| Length | 37 residues |
| Sequence | KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP |
| N-terminal modification | Lys1: C20 diacid via γGlu |
| Disulfide | Cys2–Cys7 |
| C-terminus | Amide (Pro37-NH2) |
| CAS number | 1415456-99-3 |
| Receptor design | Amylin receptors (AMY1–3) and the calcitonin receptor (CALCR) |
| Form | White lyophilized powder |
| Vial sizes | 5 mg |
| Purity specification | ≥95% (HPLC-UV) |
| Purity, current lots | 99.91% |
| Identity specification | Confirmed by LC-MS |
| Testing laboratory | Freedom Diagnostics (independent) |
| Storage | Store sealed, dry and protected from light at the temperature stated on the vial label. Allow a cold vial to reach room temperature before opening. |
| Designation | Research use only |
Current lot results against specification
Every current lot meets the release specification. Current lots test at 99.91% by HPLC-UV against a specification of ≥95%, and identity is confirmed by LC-MS on every lot.
Cagrilintide molecular formula
The molecular formula of Cagrilintide is C194H312N54O59S2. Includes the C20 diacid-γGlu side chain, the Cys2–Cys7 disulfide and the C-terminal amide.
Cagrilintide molecular weight
The average molecular weight of Cagrilintide is 4409.07 g/mol. "Average" means it is calculated from natural isotope abundances, which is the value used to predict the ions seen in LC-MS. With this weight, Cagrilintide is expected at m/z 1470.7 with three charges and m/z 1103.3 with four charges.
Cagrilintide sequence
KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
One-letter code, N- to C-terminus. Lys1 is acylated (C20 diacid-γGlu); Cys2 and Cys7 form a disulfide; Pro37 is amidated.
Structure and modifications
Lys1 carries an eicosanedioic acid (C20 diacid) linked through γ-glutamate; the Cys2–Cys7 disulfide forms an N-terminal ring; and Pro37 is amidated. The lipid chain makes the molecule strongly hydrophobic, so it elutes late on reversed-phase HPLC, much like other fatty-acid-modified peptides.
Receptor classification
Cagrilintide is designed for activity at the amylin receptors (AMY1–3) and the calcitonin receptor (CALCR). Amylin receptors are the calcitonin receptor paired with one of three receptor activity-modifying proteins (RAMP1–3).
Physical form
White lyophilized powder, recorded as the appearance on every certificate. Lyophilization (freeze-drying) removes water, which slows most chemical degradation. What lyophilized means.
Purity and identity specifications
Cagrilintide Labs’ stated release specification is ≥95% HPLC-UV purity with identity confirmed by LC-MS. The current lot, KB17122, reported 99.91%. How purity is measured, or how specifications fit into the quality and supply-chain process.
Analytical and testing methods
HPLC-UV for purity, LC-MS for identity and laboratory quantitation for net content, performed on every lot by Freedom Diagnostics. LAL endotoxin testing (USP <85>) and PCR microbial screening are reported for lots where they were run. Testing and quality control.
Research designation
Cagrilintide is designated research use only: supplied for laboratory research by qualified personnel. Research use only policy.
Buy Cagrilintide
5 mg vials. Current lot KB17122 tested at 99.91% purity with identity confirmed by LC-MS. Current purchasing is available through Klow.bio.